PaperBLAST – Find papers about a protein or its homologs

 

Align Q17958 to PF06840 (DUF1241)

Q17958 has 215 amino acids

Query:       DUF1241  [M=150]
Accession:   PF06840.11
Description: Protein of unknown function (DUF1241)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    5.8e-56  174.5   0.1    8.7e-56  173.9   0.1    1.2  1  Q17958    


Domain annotation for each sequence (and alignments):
>> Q17958  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  173.9   0.1   8.7e-56   8.7e-56       3     149 ..       7     160 ..       5     161 .. 0.94

  Alignments for each domain:
  == domain 1  score: 173.9 bits;  conditional E-value: 8.7e-56
  DUF1241   3 lvaslvlqvllrpvldklekkd......vaaaqtLraalskaekesPgltqdlvkgllkkkelsvnlneslLrlqgtadteeykversee..efqeLnkkar 96 
              +++++++q+l++pv++k++++         a ++L++al+++e++sP++++d++k+ll+++elsvnl+es+Lr+++t++t++++v+  e+  +++eL+k+a+
   Q17958   7 YLGAMTYQCLYSPVMEKIKQQHrddpraSLALNKLHTALTTCEQASPSFLYDFTKVLLDDSELSVNLQESYLRMHDTSPTNDLIVSGYEQnaDYKELTKRAI 108
              7899***************763348998899********************************************************999889********* PP

  DUF1241  97 aLkkiLsriPdeindRktfLetIkeiAsaIkklLdavnevlkkiqekeekqal 149
              +L+++Lsr+P+e++dR++fLetIk iAs+IkklL+a+n+v++ ++  +++ a+
   Q17958 109 ELRRVLSRVPEEMSDRHAFLETIKLIASSIKKLLEAINAVYRIVPL-TAQPAV 160
              ******************************************9998.666665 PP



Or compare Q17958 to CDD or PaperBLAST