PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9BUL8 to PF06840 (DUF1241)

SwissProt::Q9BUL8 has 212 amino acids

Query:       DUF1241  [M=150]
Accession:   PF06840.11
Description: Protein of unknown function (DUF1241)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.1e-67  212.5   3.4    1.5e-67  212.1   3.4    1.2  1  SwissProt::Q9BUL8  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9BUL8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.1   3.4   1.5e-67   1.5e-67       2     150 .]      15     161 ..      14     161 .. 0.98

  Alignments for each domain:
  == domain 1  score: 212.1 bits;  conditional E-value: 1.5e-67
            DUF1241   2 slvaslvlqvllrpvldklekkdvaaaqtLraalskaekesPgltqdlvkgllkkkelsvnlneslLrlqgtadteeykverseeefqeLnk 93 
                        ++++s++l+++++pv+++le+ +++aaqtLraa++kaeke+Pgltqd+++++l+kk+++vn++eslLr++++ d+eey++er e efq+Ln+
  SwissProt::Q9BUL8  15 TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAAD-DVEEYMIERPEPEFQDLNE 105
                        5789********************************************************************.******************* PP

            DUF1241  94 karaLkkiLsriPdeindRktfLetIkeiAsaIkklLdavnevlkkiqekeekqale 150
                        karaLk+iLs+iPdeindR +fL+tIk+iAsaIk+lLd+vn+v+kk+q  ++++ale
  SwissProt::Q9BUL8 106 KARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 161
                        *************************************************.8999987 PP



Or compare SwissProt::Q9BUL8 to CDD or PaperBLAST