PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006232563.1 to PF06840 (DUF1241)

XP_006232563.1 has 210 amino acids

Query:       DUF1241  [M=150]
Accession:   PF06840.11
Description: Protein of unknown function (DUF1241)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.3e-67  212.3   3.4    1.8e-67  211.8   3.4    1.2  1  XP_006232563.1  


Domain annotation for each sequence (and alignments):
>> XP_006232563.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  211.8   3.4   1.8e-67   1.8e-67       3     150 .]      14     159 ..      12     159 .. 0.98

  Alignments for each domain:
  == domain 1  score: 211.8 bits;  conditional E-value: 1.8e-67
         DUF1241   3 lvaslvlqvllrpvldklekkdvaaaqtLraalskaekesPgltqdlvkgllkkkelsvnlneslLrlqgtadteeykverseeefqeLnkkara 97 
                     +++s++l+++++pv+++le+ +++aaqtLraa++kaeke+Pgltqd+++++l+kk+++vn++eslLr++++ d+eey++er e efq+Ln+kara
  XP_006232563.1  14 SMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAAD-DVEEYMIERPEPEFQDLNEKARA 107
                     689********************************************************************.*********************** PP

         DUF1241  98 LkkiLsriPdeindRktfLetIkeiAsaIkklLdavnevlkkiqekeekqale 150
                     Lk+iLs+iPdeindR +fL+tIk+iAsaIk+lLd+vn+v+kk+q  ++++ale
  XP_006232563.1 108 LKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 159
                     *********************************************.8999987 PP



Or compare XP_006232563.1 to CDD or PaperBLAST