PaperBLAST – Find papers about a protein or its homologs

 

Align XP_016861134.1 to PF06840 (DUF1241)

XP_016861134.1 has 149 amino acids

Query:       DUF1241  [M=150]
Accession:   PF06840.11
Description: Protein of unknown function (DUF1241)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.4e-46  144.0   3.1      2e-46  143.5   3.1    1.2  1  XP_016861134.1  


Domain annotation for each sequence (and alignments):
>> XP_016861134.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  143.5   3.1     2e-46     2e-46      51     150 .]       1      98 [.       1      98 [. 0.98

  Alignments for each domain:
  == domain 1  score: 143.5 bits;  conditional E-value: 2e-46
         DUF1241  51 kgllkkkelsvnlneslLrlqgtadteeykverseeefqeLnkkaraLkkiLsriPdeindRktfLetIkeiAsaIkklLdavnevlkkiqekee 145
                     +++l+kk+++vn++eslLr++++ d+eey++er e efq+Ln+karaLk+iLs+iPdeindR +fL+tIk+iAsaIk+lLd+vn+v+kk+q  ++
  XP_016861134.1   1 MKILEKKSVEVNFTESLLRMAAD-DVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QN 93 
                     689********************.********************************************************************.89 PP

         DUF1241 146 kqale 150
                     ++ale
  XP_016861134.1  94 RRALE 98 
                     99987 PP



Or compare XP_016861134.1 to CDD or PaperBLAST