VIMSS217149 has 74 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-24 71.7 5.7 2.7e-24 71.1 5.7 1.3 1 VIMSS217149
Domain annotation for each sequence (and alignments):
>> VIMSS217149
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.1 5.7 2.7e-24 2.7e-24 1 47 [. 19 64 .. 19 65 .. 0.98
Alignments for each domain:
== domain 1 score: 71.1 bits; conditional E-value: 2.7e-24
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47
sPC+++C ld e+++C+GC+Rt++Ei +W rm+++erravl+r++er
VIMSS217149 19 SPCVSICALD-EQDICTGCQRTVAEIGRWGRMDNDERRAVLKRCHER 64
9*********.**********************************99 PP
Or compare VIMSS217149 to CDD or PaperBLAST