D7TZU6 has 809 amino acids
Query: GIP1_N [M=60]
Accession: PF06972.15
Description: GBF-interacting protein 1 N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-37 111.6 0.8 1.4e-36 110.8 0.8 1.4 1 D7TZU6
Domain annotation for each sequence (and alignments):
>> D7TZU6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 110.8 0.8 1.4e-36 1.4e-36 2 60 .] 15 73 .. 14 73 .. 0.98
Alignments for each domain:
== domain 1 score: 110.8 bits; conditional E-value: 1.4e-36
GIP1_N 2 pasvrkviqsikEivgkhsdeeiyamLkecnmDpneavqkLLsqDtFheVkskrdkkKE 60
pa vrk+iqsikEivg+hsd++iy +L+e+nmDpne++qkLL+qD+FheVk+krdkkKE
D7TZU6 15 PARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQDPFHEVKRKRDKKKE 73
899*******************************************************9 PP
Or compare D7TZU6 to CDD or PaperBLAST