PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1293918 to PF06998 (DUF1307)

VIMSS1293918 has 151 amino acids

Query:       DUF1307  [M=123]
Accession:   PF06998.11
Description: Protein of unknown function (DUF1307)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.1e-41  125.8  15.3    5.9e-41  125.6  15.3    1.0  1  VIMSS1293918  


Domain annotation for each sequence (and alignments):
>> VIMSS1293918  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  125.6  15.3   5.9e-41   5.9e-41       1     123 []      25     143 ..      25     143 .. 0.98

  Alignments for each domain:
  == domain 1  score: 125.6 bits;  conditional E-value: 5.9e-41
                   EEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEETTTSS-SSHHHHHHHHHHHHTTTTTSSS-EEEEEE-SSEEEEEEEEETTS--HHHHTTTT-- CS
       DUF1307   1 etktytanengadikltytykgDkvlkqtaeskitysdlgvetkeeakeklesleekYkgikGvsekltykddkliekvtidyekadldelkkldgv 97 
                   +tkty+++ +g+++ +++tyk+Dkvlkq+++++i+y+dlg+ +k+eak+++++ e+ +k++kGv++k++ykd+k+ie+++idy+++d+++l+k +gv
  VIMSS1293918  25 QTKTYEGDVSGKHVLTSITYKDDKVLKQSTINTIKYDDLGM-DKDEAKKLFAKSESIFKDLKGVKYKVDYKDKKAIEHLDIDYTEVDMKKLNKRLGV 120
                   79***************************************.******************************************************* PP

                   TT-HHHHHH--BHHHHHHHHHHTT-- CS
       DUF1307  98 ttqkekkkkkislkktekllekqGyk 123
                   +t+++   k+is++k ek+l+++G+k
  VIMSS1293918 121 STKEN---KDISFEKLEKQLKHRGLK 143
                   **985...89**************86 PP



Or compare VIMSS1293918 to CDD or PaperBLAST