PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS153943 to PF06998 (DUF1307)

VIMSS153943 has 176 amino acids

Query:       DUF1307  [M=123]
Accession:   PF06998.11
Description: Protein of unknown function (DUF1307)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.3e-43  133.4   1.7    3.3e-43  132.9   1.7    1.2  1  VIMSS153943  


Domain annotation for each sequence (and alignments):
>> VIMSS153943  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  132.9   1.7   3.3e-43   3.3e-43       1     123 []      52     173 ..      52     173 .. 0.98

  Alignments for each domain:
  == domain 1  score: 132.9 bits;  conditional E-value: 3.3e-43
                  EEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEETTTSS-SSHHHHHHHHHHHHTTTTTSSS-EEEEEE-SSEEEEEEEEETTS--HHHHTTTT--T CS
      DUF1307   1 etktytanengadikltytykgDkvlkqtaeskitysdlgvetkeeakeklesleekYkgikGvsekltykddkliekvtidyekadldelkkldgvt 98 
                  et++y +n ng++iklty+ykgD vl+q +e+k+ y++l++++keea+++l+++ e+Y+g+ G++e+++y d++++e v+id+++a++++l+kl+g +
  VIMSS153943  52 ETQRYVGNLNGIEIKLTYYYKGDIVLRQISEHKLLYKTLKANNKEEAQKMLSQVGEAYQGMPGLTERIDYYDSYATEYVDIDFTQAKISDLCKLPGSS 149
                  79************************************************************************************************ PP

                  T-HHHHHH--BHHHHHHHHHHTT-- CS
      DUF1307  99 tqkekkkkkislkktekllekqGyk 123
                  ++++ ++ ++s+ +++klle++Gy+
  VIMSS153943 150 IDNC-SAYYLSMIRSQKLLEESGYH 173
                  ***8.566***************96 PP



Or compare VIMSS153943 to CDD or PaperBLAST