PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS156437 to PF06998 (DUF1307)

VIMSS156437 has 153 amino acids

Query:       DUF1307  [M=123]
Accession:   PF06998.11
Description: Protein of unknown function (DUF1307)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-48  150.1  14.3    1.8e-48  149.9  14.3    1.0  1  VIMSS156437  


Domain annotation for each sequence (and alignments):
>> VIMSS156437  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  149.9  14.3   1.8e-48   1.8e-48       1     123 []      28     149 ..      28     149 .. 0.99

  Alignments for each domain:
  == domain 1  score: 149.9 bits;  conditional E-value: 1.8e-48
                  EEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEETTTSS-SSHHHHHHHHHHHHTTTTTSSS-EEEEEE-SSEEEEEEEEETTS--HHHHTTTT--T CS
      DUF1307   1 etktytanengadikltytykgDkvlkqtaeskitysdlgvetkeeakeklesleekYkgikGvsekltykddkliekvtidyekadldelkkldgvt 98 
                  etktyt+++ng+d kltytykgDkv+kqtae++++y++lgv +ke+a+++l+++++k++gi+G++ek++ykddk+ie++++dy+k+  ++++k++g++
  VIMSS156437  28 ETKTYTLSQNGVDSKLTYTYKGDKVTKQTAENTMSYASLGVASKEDAEKMLKATSDKFQGIDGLKEKIEYKDDKAIETLEVDYTKISSEDMNKIPGMS 125
                  79************************************************************************************************ PP

                  T-HHHHHH--BHHHHHHHHHHTT-- CS
      DUF1307  99 tqkekkkkkislkktekllekqGyk 123
                  +++ +++k+is++++ k+le+qGyk
  VIMSS156437 126 SNG-DTSKGISMEESAKMLESQGYK 149
                  **9.8*******************7 PP



Or compare VIMSS156437 to CDD or PaperBLAST