PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS16231 to PF06998 (DUF1307)

VIMSS16231 has 153 amino acids

Query:       DUF1307  [M=123]
Accession:   PF06998.11
Description: Protein of unknown function (DUF1307)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.2e-46  142.6   8.1    3.7e-46  142.4   8.1    1.0  1  VIMSS16231  


Domain annotation for each sequence (and alignments):
>> VIMSS16231  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  142.4   8.1   3.7e-46   3.7e-46       1     123 []      28     150 ..      28     150 .. 0.99

  Alignments for each domain:
  == domain 1  score: 142.4 bits;  conditional E-value: 3.7e-46
                 EEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEETTTSS-SSHHHHHHHHHHHHTTTTTSSS-EEEEEE-SSEEEEEEEEETTS--HHHHTTTT--TT CS
     DUF1307   1 etktytanengadikltytykgDkvlkqtaeskitysdlgvetkeeakeklesleekYkgikGvsekltykddkliekvtidyekadldelkkldgvtt 99 
                 e+k+++an ng++i +ty ykgDkvlkq++e+ki+++++g++tke+a ++le+l++kYk+i+Gv+eklty+d++++e+vtid+ek+d+++l+ ++g+++
  VIMSS16231  28 ESKKFSANLNGTEIAITYVYKGDKVLKQSSETKIQFASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTIDMEKVDFKALQGISGINV 126
                 689************************************************************************************************ PP

                 -HHHHHH--BHHHHHHHHHHTT-- CS
     DUF1307 100 qkekkkkkislkktekllekqGyk 123
                 ++e++kk+i++ ++e +++++G+k
  VIMSS16231 127 SAEDAKKGITMAQMELVMKAAGFK 150
                 ***********************7 PP



Or compare VIMSS16231 to CDD or PaperBLAST