PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2059559 to PF06998 (DUF1307)

VIMSS2059559 has 163 amino acids

Query:       DUF1307  [M=123]
Accession:   PF06998.11
Description: Protein of unknown function (DUF1307)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.6e-30   91.2  13.2      3e-30   91.0  13.2    1.1  1  VIMSS2059559  


Domain annotation for each sequence (and alignments):
>> VIMSS2059559  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   91.0  13.2     3e-30     3e-30       9     123 .]      39     152 ..      29     152 .. 0.95

  Alignments for each domain:
  == domain 1  score: 91.0 bits;  conditional E-value: 3e-30
                   ETTEEEEEEEEEETTEEEEEEEEEEEETTTSS-SSHHHHHHHHHHHHTTTTTSSS-EEEEEE-SSEEEEEEEEETTS--HHHHTTTT--TT-HHHHH CS
       DUF1307   9 engadikltytykgDkvlkqtaeskitysdlgvetkeeakeklesleekYkgikGvsekltykddkliekvtidyekadldelkkldgvttqkekkk 105
                   + + d ++t +ykgD++l ++++++ +y+ +g+ tk+ ake+ e++++  +gikG+++k++ykdd+l+ek+tid++kad++el++++ ++t++++k+
  VIMSS2059559  39 NTKQDSRITVEYKGDELLINETNNTFYYKPVGL-TKDTAKEQTEAYAKSIEGIKGLTHKIEYKDDYLTEKLTIDFSKADIEELQSKQLLQTSGNQKA 134
                   456789***************************.*************************************************************** PP

                   H--BHHHHHHHHHHTT-- CS
       DUF1307 106 kkislkktekllekqGyk 123
                   ++is k+t kllek+Gyk
  VIMSS2059559 135 DYISYKETAKLLEKAGYK 152
                   *****************7 PP



Or compare VIMSS2059559 to CDD or PaperBLAST