VIMSS7847 has 141 amino acids
Query: Phage_Mu_Gp36 [M=124] Accession: PF07030.16 Description: Bacteriophage Mu, Gp36 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-46 142.9 0.4 3.3e-46 142.7 0.4 1.0 1 VIMSS7847 Domain annotation for each sequence (and alignments): >> VIMSS7847 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 142.7 0.4 3.3e-46 3.3e-46 1 123 [. 4 126 .. 4 127 .. 0.98 Alignments for each domain: == domain 1 score: 142.7 bits; conditional E-value: 3.3e-46 Phage_Mu_Gp36 1 YatlddlidrlgedeliqltdreeegaideavveealadAsaeiDsyLakRyalPLatvpevlkrlavdiarYrLysreateevkkrYkdalklLe 96 Ya++++li+r++ + l q++ e++ +dea v+eal+dAs++iDsyL++Ry+lPL+tvp+vl+r+++ iarY+L +++at++++++Y+d++++Le VIMSS7847 4 YANRESLIKRYTLKVLEQIAWLPEAQSLDEAKVQEALEDASQTIDSYLGGRYVLPLKTVPAVLERHCCYIARYFLEKNRATDQARQDYEDTIRFLE 99 9*********************************************************************************************** PP Phage_Mu_Gp36 97 kvakGklsLgladteetapeseegrva 123 kva+G +sLgl+d++et++++++++++ VIMSS7847 100 KVASGAISLGLSDDDETVESENGAMME 126 *******************99999876 PP
Or compare VIMSS7847 to CDD or PaperBLAST