PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001278515.1 to PF07092 (DUF1356)

NP_001278515.1 has 262 amino acids

Query:       DUF1356  [M=232]
Accession:   PF07092.12
Description: Protein of unknown function (DUF1356)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   7.6e-118  377.9   3.7   8.8e-118  377.7   3.7    1.0  1  NP_001278515.1  


Domain annotation for each sequence (and alignments):
>> NP_001278515.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  377.7   3.7  8.8e-118  8.8e-118       3     231 ..      27     251 ..      25     252 .. 0.99

  Alignments for each domain:
  == domain 1  score: 377.7 bits;  conditional E-value: 8.8e-118
         DUF1356   3 eskadsyssekeskedvsqvpyveatgrdsvtCptCqGtGeiPreqekqLvaLiPysdqrLkPrrtklyvllavliCLllsgLvvffLfPrsiav 97 
                     +ska +yss+ +sk+++s+vp++  + +++vtCptCqG+G+iP+e+ekqLvaLiPy+dqrLkP++tkl+v+lavliCL++s+++vffLfPrs+ v
  NP_001278515.1  27 GSKAVNYSSTGSSKSFCSCVPCEGTADASFVTCPTCQGSGKIPQELEKQLVALIPYGDQRLKPKHTKLFVFLAVLICLVTSSFIVFFLFPRSVIV 121
                     678999***************************************************************************************** PP

         DUF1356  98 epvGlksskvafdkeeksvlLnitnvLnisnsnyypvtvtqltaevlylktvvGkvkkslllligPldskqvdytvaskiadeltylykiCtllk 192
                     +p+Gl+ss+vafd  e++++Lnitn+Lnisn nyyp+ vtqlt evl+l++vvG+v+++lll+igPl+s+q++y+va+ki de+ty  kiCt+l+
  NP_001278515.1 122 QPAGLNSSTVAFD--EADIYLNITNILNISNGNYYPIMVTQLTLEVLHLSLVVGQVSNNLLLHIGPLASEQMFYAVATKIRDENTY--KICTWLE 212
                     *************..***********************************************************************..******* PP

         DUF1356 193 ikvhnillliqgtltlsylshseqlslesyeyvdCrgnt 231
                     ikvh++ll+iqgtlt+sylshseql+++syeyvdCrgn 
  NP_001278515.1 213 IKVHHVLLHIQGTLTCSYLSHSEQLVFQSYEYVDCRGNA 251
                     **************************************7 PP



Or compare NP_001278515.1 to CDD or PaperBLAST