PaperBLAST – Find papers about a protein or its homologs

 

Align NP_060844.2 to PF07092 (DUF1356)

NP_060844.2 has 274 amino acids

Query:       DUF1356  [M=232]
Accession:   PF07092.12
Description: Protein of unknown function (DUF1356)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   3.1e-123  395.6   6.1   3.6e-123  395.4   6.1    1.0  1  NP_060844.2  


Domain annotation for each sequence (and alignments):
>> NP_060844.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  395.4   6.1  3.6e-123  3.6e-123       6     232 .]      32     258 ..      27     258 .. 0.99

  Alignments for each domain:
  == domain 1  score: 395.4 bits;  conditional E-value: 3.6e-123
      DUF1356   6 adsyssekeskedvsqvpyveatgrdsvtCptCqGtGeiPreqekqLvaLiPysdqrLkPrrtklyvllavliCLllsgLvvffLfPrsiavepvGlk 103
                  ++++++e++++ dvsq+pyve+tgrdsvtCptCqGtG+iPr+qe+qLvaLiPysdqrL+Prrtklyv+++v++CLllsgL+vffLfPrsi+v+++G+k
  NP_060844.2  32 NSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVK 129
                  678999******************************************************************************************** PP

      DUF1356 104 sskvafdkeeksvlLnitnvLnisnsnyypvtvtqltaevlylktvvGkvkkslllligPldskqvdytvaskiadeltylykiCtllkikvhnilll 201
                  s++v++d+++++++Lnitn+Lni+n+nyy+v+v+++ta+v+++ktv+Gk++ ++++ igPld+kq+dytv++ ia+e++y+y++Ctl++ikvhni+l+
  NP_060844.2 130 SAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLM 227
                  ************************************************************************************************** PP

      DUF1356 202 iqgtltlsylshseqlslesyeyvdCrgntt 232
                  +q+t+t++y++hseq+s+e+y+yvdC++ntt
  NP_060844.2 228 MQVTVTTTYFGHSEQISQERYQYVDCGRNTT 258
                  *****************************97 PP



Or compare NP_060844.2 to CDD or PaperBLAST