PaperBLAST – Find papers about a protein or its homologs

 

Align NP_659079.1 to PF07092 (DUF1356)

NP_659079.1 has 261 amino acids

Query:       DUF1356  [M=232]
Accession:   PF07092.12
Description: Protein of unknown function (DUF1356)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   6.8e-116  371.5   0.7   7.8e-116  371.4   0.7    1.0  1  NP_659079.1  


Domain annotation for each sequence (and alignments):
>> NP_659079.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  371.4   0.7  7.8e-116  7.8e-116       2     232 .]      25     251 ..      24     251 .. 0.99

  Alignments for each domain:
  == domain 1  score: 371.4 bits;  conditional E-value: 7.8e-116
      DUF1356   2 veskadsyssekeskedvsqvpyveatgrdsvtCptCqGtGeiPreqekqLvaLiPysdqrLkPrrtklyvllavliCLllsgLvvffLfPrsiavep 99 
                  ++s+a++y s+ +sk+++s++py++a+++++vtCptCqG+GeiP+eqekqLvaLiPy+dqrLkPrrtkl+v+l+v+iCLl+++L++ffL+Pr iav+p
  NP_659079.1  25 MASQAANYFSTGSSKPAHSCMPYEKAASSSFVTCPTCQGNGEIPQEQEKQLVALIPYGDQRLKPRRTKLFVFLSVAICLLIFSLTIFFLYPRPIAVRP 122
                  678999******************************************************************************************** PP

      DUF1356 100 vGlksskvafdkeeksvlLnitnvLnisnsnyypvtvtqltaevlylktvvGkvkkslllligPldskqvdytvaskiadeltylykiCtllkikvhn 197
                  vGl+ss+v+f+  +++v+Ln tnvLni nsn+yp+tvtqltaevl++ +vvG+v++sl+l+igPl+s+q+ y+vas+i de+ty  kiCt++ki+vh+
  NP_659079.1 123 VGLNSSTVTFE--DAHVQLNTTNVLNIFNSNFYPITVTQLTAEVLHQASVVGQVTSSLRLHIGPLASEQMPYEVASRILDENTY--KICTWPKIRVHH 216
                  ***********..***********************************************************************..************ PP

      DUF1356 198 illliqgtltlsylshseqlslesyeyvdCrgntt 232
                  ill+iqg+lt+s+lsh +ql++es+eyvdCr+n++
  NP_659079.1 217 ILLNIQGSLTCSFLSHPQQLPFESFEYVDCRENMS 251
                  *********************************86 PP



Or compare NP_659079.1 to CDD or PaperBLAST