PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q6AYA5 to PF07092 (DUF1356)

SwissProt::Q6AYA5 has 275 amino acids

Query:       DUF1356  [M=232]
Accession:   PF07092.12
Description: Protein of unknown function (DUF1356)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   1.6e-123  396.5   3.9   1.9e-123  396.3   3.9    1.0  1  SwissProt::Q6AYA5  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q6AYA5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  396.3   3.9  1.9e-123  1.9e-123       6     232 .]      33     259 ..      28     259 .. 0.98

  Alignments for each domain:
  == domain 1  score: 396.3 bits;  conditional E-value: 1.9e-123
            DUF1356   6 adsyssekeskedvsqvpyveatgrdsvtCptCqGtGeiPreqekqLvaLiPysdqrLkPrrtklyvllavliCLllsgLvvffLfPrsiav 97 
                        ++++ +e+++  dvsq+pyve+tgrdsvtCptCqGtG+iPr+qe+qLvaLiPysdqrL+Prrtklyv+++v++CLllsgL+vffLfPrsi+v
  SwissProt::Q6AYA5  33 SSEVRNEDGRSGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDV 124
                        56788999************************************************************************************ PP

            DUF1356  98 epvGlksskvafdkeeksvlLnitnvLnisnsnyypvtvtqltaevlylktvvGkvkkslllligPldskqvdytvaskiadeltylykiCt 189
                        +++G+ks++v++d ++++++Lnitn+Lni+n+nyy+v+v+++ta+v+++ktv+Gk++ s++++igPld+kq+dytv++ ia+e++y+y++Ct
  SwissProt::Q6AYA5 125 KYIGVKSAYVSYDSQKRMIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLSNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCT 216
                        ******************************************************************************************** PP

            DUF1356 190 llkikvhnillliqgtltlsylshseqlslesyeyvdCrgntt 232
                        l++ikvhni+l++q+t+t++y++hseq+s+e+y+yvdC++ntt
  SwissProt::Q6AYA5 217 LPSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTT 259
                        *****************************************97 PP



Or compare SwissProt::Q6AYA5 to CDD or PaperBLAST