PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9BVX2 to PF07092 (DUF1356)

SwissProt::Q9BVX2 has 250 amino acids

Query:       DUF1356  [M=232]
Accession:   PF07092.12
Description: Protein of unknown function (DUF1356)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   3.9e-103  329.8   3.7   4.7e-103  329.5   3.7    1.0  1  SwissProt::Q9BVX2  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9BVX2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  329.5   3.7  4.7e-103  4.7e-103       4     232 .]      20     248 ..      17     248 .. 0.98

  Alignments for each domain:
  == domain 1  score: 329.5 bits;  conditional E-value: 4.7e-103
            DUF1356   4 skadsyssekeskedvsqvpyveatgrdsvtCptCqGtGeiPreqekqLvaLiPysdqrLkPrrtklyvllavliCLllsgLvvffLfPrsi 95 
                        +++d + +e+e++e+++q+pyve+tgrds+tC tCqGtG+iP+eq+++LvaLiP+sdqrL+P+rtk+yvll++l+CLl+sgLvvffLfP+s+
  SwissProt::Q9BVX2  20 DDRDGLLAEREQEEAIAQFPYVEFTGRDSITCLTCQGTGYIPTEQVNELVALIPHSDQRLRPQRTKQYVLLSILLCLLASGLVVFFLFPHSV 111
                        567778899*********************************************************************************** PP

            DUF1356  96 avepvGlksskvafdkeeksvlLnitnvLnisnsnyypvtvtqltaevlylktvvGkvkkslllligPldskqvdytvaskiadeltylyki 187
                        +v++ G+k++kv+f+k+++ v+L+i ++L+i nsn+y+v+vt+l+++++y++tvv ++ +++++li P++++ v++t ++++   ++y+y +
  SwissProt::Q9BVX2 112 LVDDDGIKVVKVTFNKQDSLVILTIMATLKIRNSNFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGGPFSYVYFF 203
                        ******************************************************************************************** PP

            DUF1356 188 CtllkikvhnillliqgtltlsylshseqlslesyeyvdCrgntt 232
                        Ct+++i vhni++++++++++sy++ ++q+sle+++yvdC+gn+t
  SwissProt::Q9BVX2 204 CTVPEILVHNIVIFMRTSVKISYIGLMTQSSLETHHYVDCGGNST 248
                        *******************************************86 PP



Or compare SwissProt::Q9BVX2 to CDD or PaperBLAST