PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006505232.1 to PF07092 (DUF1356)

XP_006505232.1 has 275 amino acids

Query:       DUF1356  [M=232]
Accession:   PF07092.12
Description: Protein of unknown function (DUF1356)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.5e-123  396.6   4.4   1.7e-123  396.4   4.4    1.0  1  XP_006505232.1  


Domain annotation for each sequence (and alignments):
>> XP_006505232.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  396.4   4.4  1.7e-123  1.7e-123       6     232 .]      33     259 ..      28     259 .. 0.99

  Alignments for each domain:
  == domain 1  score: 396.4 bits;  conditional E-value: 1.7e-123
         DUF1356   6 adsyssekeskedvsqvpyveatgrdsvtCptCqGtGeiPreqekqLvaLiPysdqrLkPrrtklyvllavliCLllsgLvvffLfPrsiavepv 100
                     ++++++e++++ dvsq+pyve+tgrdsvtCptCqGtG+iPr+qe+qLvaLiPysdqrL+Prrtklyv+++v++CLllsgL+vffLfPrsi+v+++
  XP_006505232.1  33 SSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIEVKYI 127
                     5788999**************************************************************************************** PP

         DUF1356 101 GlksskvafdkeeksvlLnitnvLnisnsnyypvtvtqltaevlylktvvGkvkkslllligPldskqvdytvaskiadeltylykiCtllkikv 195
                     G+ks++v++d e+++++Lnitn+Lni+n+nyy+v+v+++ta+v+++ktv+Gk++ +++++igPld+kq+dytv++ ia+e++y+y++Ctll+ikv
  XP_006505232.1 128 GVKSAYVSYDAEKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLLSIKV 222
                     *********************************************************************************************** PP

         DUF1356 196 hnillliqgtltlsylshseqlslesyeyvdCrgntt 232
                     hni+l++q+t+t++y++hseq+s+e+y+yvdC++ntt
  XP_006505232.1 223 HNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTT 259
                     ***********************************97 PP



Or compare XP_006505232.1 to CDD or PaperBLAST