VIMSS333757 has 98 amino acids
Query: DUF1375 [M=51]
Accession: PF07119.16
Description: Protein of unknown function (DUF1375)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-21 61.7 0.6 5.3e-21 61.0 0.6 1.3 1 VIMSS333757
Domain annotation for each sequence (and alignments):
>> VIMSS333757
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.0 0.6 5.3e-21 5.3e-21 1 51 [] 34 84 .. 34 84 .. 0.98
Alignments for each domain:
== domain 1 score: 61.0 bits; conditional E-value: 5.3e-21
DUF1375 1 prvYsGtrldvcrlsggyckagpvllallpllivDLPlSlvlDTllLPydl 51
p+vY+Gtrl +++l+gg+c a++++++++ ++ +DLP S++lDTllLP++l
VIMSS333757 34 PVVYAGTRLNLYALQGGCCAADRFGAEAPGYPGLDLPGSALLDTLLLPLSL 84
79***********************************************97 PP
Or compare VIMSS333757 to CDD or PaperBLAST