PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS59849 to PF07119 (DUF1375)

VIMSS59849 has 113 amino acids

Query:       DUF1375  [M=53]
Accession:   PF07119.12
Description: Protein of unknown function (DUF1375)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.8e-19   56.2   0.6    2.9e-19   55.6   0.6    1.3  1  VIMSS59849  


Domain annotation for each sequence (and alignments):
>> VIMSS59849  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   55.6   0.6   2.9e-19   2.9e-19       1      52 [.      48      99 ..      48     100 .. 0.98

  Alignments for each domain:
  == domain 1  score: 55.6 bits;  conditional E-value: 2.9e-19
     DUF1375  1 prvYsGvqtdisaLsgdgagtpapwvslatppltivDlPvslvvDTvlLPyD 52
                prvYsGv++ +++L+++++ ++ap   ++++ ++++D+++s+v+DT++LPy+
  VIMSS59849 48 PRVYSGVSYTFCRLNVKTGSPVAPAQADGILEVLALDFALSGVIDTLALPYT 99
                89*************************************************9 PP



Or compare VIMSS59849 to CDD or PaperBLAST