PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS661297 to PF07119 (DUF1375)

VIMSS661297 has 514 amino acids

Query:       DUF1375  [M=53]
Accession:   PF07119.12
Description: Protein of unknown function (DUF1375)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.2e-11   29.8   0.5      6e-11   28.9   0.5    1.4  1  VIMSS661297  


Domain annotation for each sequence (and alignments):
>> VIMSS661297  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.9   0.5     6e-11     6e-11       4      52 ..      36      83 ..      34      84 .. 0.82

  Alignments for each domain:
  == domain 1  score: 28.9 bits;  conditional E-value: 6e-11
      DUF1375  4 YsGvqtdisaLsgdgagtpapwvslatppltivDlPvslvvDTvlLPyD 52
                 YsG ++++++L   + ++p p    +  +l+++DlP+ lv+DT+lLP++
  VIMSS661297 36 YSGAALAFERLI-WQTCPPKPFSKSFWDVLVLIDLPFTLVFDTILLPVS 83
                 ***********9.5555555555566668999***************86 PP



Or compare VIMSS661297 to CDD or PaperBLAST