VIMSS1235220 has 78 amino acids
Query: DUF1391 [M=48]
Accession: PF07151.16
Description: Protein of unknown function (DUF1391)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4e-38 115.4 0.3 5.6e-38 114.9 0.3 1.2 1 VIMSS1235220
Domain annotation for each sequence (and alignments):
>> VIMSS1235220
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 114.9 0.3 5.6e-38 5.6e-38 2 46 .. 30 74 .. 29 76 .. 0.96
Alignments for each domain:
== domain 1 score: 114.9 bits; conditional E-value: 5.6e-38
DUF1391 2 kiDLGnnesLvCGvfPnqDGtftamtytksktfktetGarrWLek 46
iDLGn esLvCGvfPnqDGtftamtytksktfkte GarrWLe+
VIMSS1235220 30 TIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLER 74
59******************************************8 PP
Or compare VIMSS1235220 to CDD or PaperBLAST