D4A9W3 has 632 amino acids
Query: D-Glu_cyclase [M=143] Accession: PF07286.16 Description: D-glutamate cyclase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-54 169.4 0.0 3.6e-54 168.7 0.0 1.3 1 D4A9W3 Domain annotation for each sequence (and alignments): >> D4A9W3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 168.7 0.0 3.6e-54 3.6e-54 1 141 [. 130 270 .. 130 272 .. 0.99 Alignments for each domain: == domain 1 score: 168.7 bits; conditional E-value: 3.6e-54 D-Glu_cyclase 1 VtFliGcSfsfeeaLleaglpvrhieegrnvpmYktnielepagvfsgklvvsmrpikkdkvekavqitsrlpkvhGapvhiGdpellgikdlskp 96 VtF+++cSfs+eeaL++ag+p r+++ + + ++Ykt++++++ + f+++lvv+mrp++kdk+e+++ +t++l ++G+p+hiGdpellgik lskp D4A9W3 130 VTFIMDCSFSIEEALEQAGIPRRDLTGSGHAGAYKTAVPCATIAGFCCPLVVTMRPVPKDKLERLLLATHSLGGQQGQPIHIGDPELLGIKPLSKP 225 8*********************************************************************************************** PP D-Glu_cyclase 97 dyGdaveikegevPvFwacgvTpqeavmsaklelaithapghmlv 141 dyG ve+++g+vPvFw++++T++eav +k++la+++ pg++++ D4A9W3 226 DYGSYVECRPGDVPVFWPSHLTSLEAVIGCKAPLAFASPPGCTVM 270 ******************************************987 PP
Or compare D4A9W3 to CDD or PaperBLAST