NP_001273399.1 has 621 amino acids
Query: D-Glu_cyclase [M=143] Accession: PF07286.16 Description: D-glutamate cyclase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-54 170.2 0.0 2e-54 169.6 0.0 1.3 1 NP_001273399.1 Domain annotation for each sequence (and alignments): >> NP_001273399.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.6 0.0 2e-54 2e-54 1 143 [] 118 260 .. 118 260 .. 1.00 Alignments for each domain: == domain 1 score: 169.6 bits; conditional E-value: 2e-54 D-Glu_cyclase 1 VtFliGcSfsfeeaLleaglpvrhieegrnvpmYktnielepagvfsgklvvsmrpikkdkvekavqitsrlpkvhGapvhiGdpellgikdlsk 95 V+F++GcSfs+eeaL++aglp r+ + +++ ++Ykt++++ +++ f+++lvv+mrpi+kdk+e +v+++++l ++G+pvh+Gdpellgik+lsk NP_001273399.1 118 VAFFLGCSFSLEEALEKAGLPRRDPAGHSQAGAYKTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSK 212 89********************************************************************************************* PP D-Glu_cyclase 96 pdyGdaveikegevPvFwacgvTpqeavmsaklelaithapghmlvtd 143 p yGda+ + +gevPvFw++ +T++ av+s++++la+++ pg++++td NP_001273399.1 213 PAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLAFASIPGCTVMTD 260 **********************************************98 PP
Or compare NP_001273399.1 to CDD or PaperBLAST