P42966 has 257 amino acids
Query: D-Glu_cyclase [M=143] Accession: PF07286.16 Description: D-glutamate cyclase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-74 234.1 0.2 3e-74 233.8 0.2 1.1 1 P42966 Domain annotation for each sequence (and alignments): >> P42966 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 233.8 0.2 3e-74 3e-74 1 143 [] 106 248 .. 106 248 .. 1.00 Alignments for each domain: == domain 1 score: 233.8 bits; conditional E-value: 3e-74 D-Glu_cyclase 1 VtFliGcSfsfeeaLleaglpvrhieegrnvpmYktnielepagvfsgklvvsmrpikkdkvekavqitsrlpkvhGapvhiGdpellgikdlskp 96 V+FliGcSfsfe+aL+++g+ vrhi+eg+nv+mYktni++ pag f+g++vvsmrp++++ + +a q+tsr+p+vhG p+hiG+p ++gi+dl kp P42966 106 VGFLIGCSFSFEQALINNGIAVRHIDEGTNVSMYKTNIDCVPAGAFHGQMVVSMRPVPERLAVRAAQVTSRFPAVHGGPIHIGNPGAIGIRDLGKP 201 89********************************************************************************************** PP D-Glu_cyclase 97 dyGdaveikegevPvFwacgvTpqeavmsaklelaithapghmlvtd 143 d+Gdav+i++gevPvFwacgvTpq++ m++k+e++ithapghml+td P42966 202 DFGDAVSIRDGEVPVFWACGVTPQAVAMNVKPEMVITHAPGHMLITD 248 **********************************************9 PP
Or compare P42966 to CDD or PaperBLAST