NP_309517.1 has 85 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.2e-25 73.9 0.1 5.7e-25 73.5 0.1 1.2 1 NP_309517.1
Domain annotation for each sequence (and alignments):
>> NP_309517.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.5 0.1 5.7e-25 5.7e-25 2 55 .] 34 85 .] 33 85 .] 0.99
Alignments for each domain:
== domain 1 score: 73.5 bits; conditional E-value: 5.7e-25
YdgH_BhsA-like 2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
q++Gtis++ ++l +le++la+kAd++GAks+rI+s+++ +++l+gtA++Yk
NP_309517.1 34 QKVGTISAN-AGTNLGSLEEQLAQKADEMGAKSFRITSVTG-PNTLHGTAVIYK 85
9********.*******************************.***********9 PP
Or compare NP_309517.1 to CDD or PaperBLAST