NP_309517.1 has 85 amino acids
Query: YdgH_BhsA-like [M=55] Accession: PF07338.17 Description: YdgH/BhsA/McbA-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-25 73.9 0.1 5.7e-25 73.5 0.1 1.2 1 NP_309517.1 Domain annotation for each sequence (and alignments): >> NP_309517.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.5 0.1 5.7e-25 5.7e-25 2 55 .] 34 85 .] 33 85 .] 0.99 Alignments for each domain: == domain 1 score: 73.5 bits; conditional E-value: 5.7e-25 YdgH_BhsA-like 2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55 q++Gtis++ ++l +le++la+kAd++GAks+rI+s+++ +++l+gtA++Yk NP_309517.1 34 QKVGTISAN-AGTNLGSLEEQLAQKADEMGAKSFRITSVTG-PNTLHGTAVIYK 85 9********.*******************************.***********9 PP
Or compare NP_309517.1 to CDD or PaperBLAST