PaperBLAST – Find papers about a protein or its homologs

 

Align NP_415327.2 to PF07338 (YdgH_BhsA-like)

NP_415327.2 has 86 amino acids

Query:       YdgH_BhsA-like  [M=55]
Accession:   PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    9.3e-24   69.6   0.1    1.4e-23   69.0   0.1    1.3  1  NP_415327.2  


Domain annotation for each sequence (and alignments):
>> NP_415327.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   69.0   0.1   1.4e-23   1.4e-23       1      55 []      34      86 .]      34      86 .] 0.98

  Alignments for each domain:
  == domain 1  score: 69.0 bits;  conditional E-value: 1.4e-23
  YdgH_BhsA-like  1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
                    l p+Gt+s+t ++s+lsdle++la+kA ++GAk Y+I sa + ++++ gtA++Yk
     NP_415327.2 34 LRPAGTVSAT-GASNLSDLEDKLAEKAREQGAKGYVINSAGG-NDQMFGTATIYK 86
                    689*******.*******************************.***********9 PP



Or compare NP_415327.2 to CDD or PaperBLAST