PaperBLAST – Find papers about a protein or its homologs

 

Align NP_415630.1 to PF07338 (YdgH_BhsA-like)

NP_415630.1 has 85 amino acids

Query:       YdgH_BhsA-like  [M=55]
Accession:   PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.2e-25   73.9   0.1    5.7e-25   73.5   0.1    1.2  1  NP_415630.1  


Domain annotation for each sequence (and alignments):
>> NP_415630.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   73.5   0.1   5.7e-25   5.7e-25       2      55 .]      34      85 .]      33      85 .] 0.99

  Alignments for each domain:
  == domain 1  score: 73.5 bits;  conditional E-value: 5.7e-25
  YdgH_BhsA-like  2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
                    q++Gtis++   ++l +le++la+kAd++GAks+rI+s+++ +++l+gtA++Yk
     NP_415630.1 34 QKVGTISAN-AGTNLGSLEEQLAQKADEMGAKSFRITSVTG-PNTLHGTAVIYK 85
                    9********.*******************************.***********9 PP



Or compare NP_415630.1 to CDD or PaperBLAST