PaperBLAST – Find papers about a protein or its homologs

 

Align P64614 to PF07338 (YdgH_BhsA-like)

P64614 has 87 amino acids

Query:       YdgH_BhsA-like  [M=55]
Accession:   PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.3e-27   81.1   0.1    3.9e-27   80.4   0.1    1.4  1  P64614    


Domain annotation for each sequence (and alignments):
>> P64614  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   80.4   0.1   3.9e-27   3.9e-27       2      55 .]      35      87 .]      34      87 .] 0.98

  Alignments for each domain:
  == domain 1  score: 80.4 bits;  conditional E-value: 3.9e-27
  YdgH_BhsA-like  2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
                    + iGt+sv+gv+ss++d+++ l+kkA++kGA++Y+I++a++ g+++++tA+lYk
          P64614 35 EAIGTVSVSGVASSPMDMREMLNKKAEEKGATAYQITEARS-GDTWHATAELYK 87
                    679**************************************.***********9 PP



Or compare P64614 to CDD or PaperBLAST