PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1234117 to PF07338 (YdgH_BhsA-like)

VIMSS1234117 has 91 amino acids

Query:       YdgH_BhsA-like  [M=55]
Accession:   PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.2e-17   50.0   0.8    1.5e-17   49.7   0.2    1.4  2  VIMSS1234117  


Domain annotation for each sequence (and alignments):
>> VIMSS1234117  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.1   0.0      0.47      0.47      31      40 ..      10      19 ..      10      24 .. 0.70
   2 !   49.7   0.2   1.5e-17   1.5e-17       1      55 []      37      89 ..      37      89 .. 0.98

  Alignments for each domain:
  == domain 1  score: -3.1 bits;  conditional E-value: 0.47
  YdgH_BhsA-like 31 GAksYrIisa 40
                    GA ++ ++ +
    VIMSS1234117 10 GALAFAVTNV 19
                    6777777765 PP

  == domain 2  score: 49.7 bits;  conditional E-value: 1.5e-17
  YdgH_BhsA-like  1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
                    +++iG is++ +  s  d++++l kkAd+kGA+  + +s ++ +++++gtA +Yk
    VIMSS1234117 37 YEKIGDISTS-NEMSTADAKEDLIKKADEKGADVLVLTSGQT-DNKIHGTANIYK 89
                    689*******.*******************************.***********9 PP



Or compare VIMSS1234117 to CDD or PaperBLAST