PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS14441 to PF07338 (DUF1471)

VIMSS14441 has 78 amino acids

Query:       DUF1471  [M=56]
Accession:   PF07338.13
Description: Protein of unknown function (DUF1471)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      8e-15   40.9   0.2    1.2e-14   40.4   0.2    1.2  1  VIMSS14441  


Domain annotation for each sequence (and alignments):
>> VIMSS14441  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   40.4   0.2   1.2e-14   1.2e-14       6      56 .]      30      78 .]      28      78 .] 0.97

  Alignments for each domain:
  == domain 1  score: 40.4 bits;  conditional E-value: 1.2e-14
                EEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC..CTTEEEEEEEEE CS
     DUF1471  6 tisvsgvfgspsdledalskkAdekGAkyYrItsarennggnlhatAelYK 56
                 isvs v+ sp+ led ++  A +  A+++ +ts+r   ++n +atA+lYK
  VIMSS14441 30 HISVSSVSASPTVLEDTIADIARKYNASSWKVTSMRI--DNNSTATAVLYK 78
                79***********************************..***********9 PP



Or compare VIMSS14441 to CDD or PaperBLAST