VIMSS14467 has 91 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-17 50.1 0.2 1.5e-17 49.7 0.2 1.2 1 VIMSS14467
Domain annotation for each sequence (and alignments):
>> VIMSS14467
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 49.7 0.2 1.5e-17 1.5e-17 1 55 [] 37 89 .. 37 89 .. 0.98
Alignments for each domain:
== domain 1 score: 49.7 bits; conditional E-value: 1.5e-17
YdgH_BhsA-like 1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
+++iG is++ + s d++++l kkAd+kGA+ + +s ++ +++++gtA +Yk
VIMSS14467 37 YEKIGDISTS-NEMSTADAKEDLIKKADEKGADVLVLTSGQT-DNKIHGTANIYK 89
689*******.*******************************.***********9 PP
Or compare VIMSS14467 to CDD or PaperBLAST