PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS147938 to PF07338 (DUF1471)

VIMSS147938 has 78 amino acids

Query:       DUF1471  [M=56]
Accession:   PF07338.13
Description: Protein of unknown function (DUF1471)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-18   52.5   0.3    2.5e-18   52.2   0.3    1.1  1  VIMSS147938  


Domain annotation for each sequence (and alignments):
>> VIMSS147938  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   52.2   0.3   2.5e-18   2.5e-18       1      56 []      25      78 .]      25      78 .] 0.97

  Alignments for each domain:
  == domain 1  score: 52.2 bits;  conditional E-value: 2.5e-18
                 EEEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC..CTTEEEEEEEEE CS
      DUF1471  1 lqpigtisvsgvfgspsdledalskkAdekGAkyYrItsarennggnlhatAelYK 56
                 l+ ++ isvs v+ +ps leda+++ A+ k A+++ Its+r   +++ +atA+lYK
  VIMSS147938 25 LTDVEYISVSAVSATPSMLEDAIARLAQSKQASSWKITSMRI--DNTGYATAILYK 78
                 678999************************************..***********9 PP



Or compare VIMSS147938 to CDD or PaperBLAST