PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS148819 to PF07338 (DUF1471)

VIMSS148819 has 314 amino acids

Query:       DUF1471  [M=56]
Accession:   PF07338.13
Description: Protein of unknown function (DUF1471)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.3e-63  196.4   9.1    1.3e-24   72.3   0.4    3.6  3  VIMSS148819  


Domain annotation for each sequence (and alignments):
>> VIMSS148819  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.6   0.1   3.3e-22   3.3e-22       1      56 []      34      90 ..      34      90 .. 0.99
   2 !   63.7   0.6   6.5e-22   6.5e-22       1      56 []     118     174 ..     118     174 .. 0.99
   3 !   72.3   0.4   1.3e-24   1.3e-24       1      56 []     259     314 .]     259     314 .] 0.98

  Alignments for each domain:
  == domain 1  score: 64.6 bits;  conditional E-value: 3.3e-22
                 EEEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC...CTTEEEEEEEEE CS
      DUF1471  1 lqpigtisvsgvfgspsdledalskkAdekGAkyYrItsare.nnggnlhatAelYK 56
                 l+p+++i ++g+f+++ d+  a+s++Ad++GA+++++++++e +n+gn++++A++YK
  VIMSS148819 34 LKPYDRIVITGRFNAIGDAVSAVSRRADKEGAASFYVVDTSEfGNSGNWRVVADVYK 90
                 79******************************************************9 PP

  == domain 2  score: 63.7 bits;  conditional E-value: 6.5e-22
                  EEEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC...CTTEEEEEEEEE CS
      DUF1471   1 lqpigtisvsgvfgspsdledalskkAdekGAkyYrItsare.nnggnlhatAelYK 56 
                  l+p++t++v+g + s+++++da+ k+A++kGA++++I+++ + n+ggn+++tA +YK
  VIMSS148819 118 LEPYDTVTVQGFYRSQPEVNDAITKAAKQKGAYAFYIVRQIDaNQGGNQRITAFIYK 174
                  79******************************************************9 PP

  == domain 3  score: 72.3 bits;  conditional E-value: 1.3e-24
                  EEEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC..CTTEEEEEEEEE CS
      DUF1471   1 lqpigtisvsgvfgspsdledalskkAdekGAkyYrItsarennggnlhatAelYK 56 
                  + p+++++++g++g++++++++++k+A++kGAkyY+It++++++g+n++++A+lYK
  VIMSS148819 259 MVPFDSVKFTGNYGNMTEISYQVAKRAAKKGAKYYHITRQWQERGNNITISADLYK 314
                  679****************************************************9 PP



Or compare VIMSS148819 to CDD or PaperBLAST