VIMSS14931 has 86 amino acids
Query: YdgH_BhsA-like [M=55] Accession: PF07338.17 Description: YdgH/BhsA/McbA-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-24 69.6 0.1 1.4e-23 69.0 0.1 1.3 1 VIMSS14931 Domain annotation for each sequence (and alignments): >> VIMSS14931 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.0 0.1 1.4e-23 1.4e-23 1 55 [] 34 86 .] 34 86 .] 0.98 Alignments for each domain: == domain 1 score: 69.0 bits; conditional E-value: 1.4e-23 YdgH_BhsA-like 1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55 l p+Gt+s+t ++s+lsdle++la+kA ++GAk Y+I sa + ++++ gtA++Yk VIMSS14931 34 LRPAGTVSAT-GASNLSDLEDKLAEKAREQGAKGYVINSAGG-NDQMFGTATIYK 86 689*******.*******************************.***********9 PP
Or compare VIMSS14931 to CDD or PaperBLAST