PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS150652 to PF07338 (DUF1471)

VIMSS150652 has 87 amino acids

Query:       DUF1471  [M=56]
Accession:   PF07338.13
Description: Protein of unknown function (DUF1471)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      7e-27   79.6   0.3    1.1e-26   78.9   0.3    1.3  1  VIMSS150652  


Domain annotation for each sequence (and alignments):
>> VIMSS150652  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   78.9   0.3   1.1e-26   1.1e-26       2      56 .]      35      87 .]      34      87 .] 0.98

  Alignments for each domain:
  == domain 1  score: 78.9 bits;  conditional E-value: 1.1e-26
                 EEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC..CTTEEEEEEEEE CS
      DUF1471  2 qpigtisvsgvfgspsdledalskkAdekGAkyYrItsarennggnlhatAelYK 56
                 + ig++svs   +sp+d+++ lskkAde+GA +Y+It+ar   g+n+hatAelYK
  VIMSS150652 35 EAIGSVSVSAIGSSPMDMNAMLSKKADEQGATAYHITEARS--GSNWHATAELYK 87
                 579**************************************..***********9 PP



Or compare VIMSS150652 to CDD or PaperBLAST