VIMSS152933 has 85 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-25 74.7 0.0 3.3e-25 74.2 0.0 1.2 1 VIMSS152933
Domain annotation for each sequence (and alignments):
>> VIMSS152933
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.2 0.0 3.3e-25 3.3e-25 2 55 .] 34 85 .] 33 85 .] 0.99
Alignments for each domain:
== domain 1 score: 74.2 bits; conditional E-value: 3.3e-25
YdgH_BhsA-like 2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
q++Gtis++ + ++l +le++la+kA+++GAks+rI+s+++ +++l+gtA++Yk
VIMSS152933 34 QKFGTISAN-GGTNLGSLEDQLAQKAQEMGAKSFRITSVTG-PNTLHGTAVIYK 85
9********.*******************************.***********9 PP
Or compare VIMSS152933 to CDD or PaperBLAST