PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS15725 to PF07338 (DUF1471)

VIMSS15725 has 314 amino acids

Query:       DUF1471  [M=56]
Accession:   PF07338.13
Description: Protein of unknown function (DUF1471)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.5e-65  202.7   6.9    3.6e-25   74.1   0.2    3.5  3  VIMSS15725  


Domain annotation for each sequence (and alignments):
>> VIMSS15725  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   65.6   0.0   1.6e-22   1.6e-22       2      56 .]      35      90 ..      34      90 .. 0.98
   2 !   65.3   0.4     2e-22     2e-22       2      56 .]     119     174 ..     118     174 .. 0.98
   3 !   74.1   0.2   3.6e-25   3.6e-25       1      56 []     259     314 .]     259     314 .] 0.98

  Alignments for each domain:
  == domain 1  score: 65.6 bits;  conditional E-value: 1.6e-22
                EEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC...CTTEEEEEEEEE CS
     DUF1471  2 qpigtisvsgvfgspsdledalskkAdekGAkyYrItsare.nnggnlhatAelYK 56
                +p++++ v+g+f+++ ++ +a+s++Ad++GA++++++++++ +n+gn++++A+lYK
  VIMSS15725 35 KPFDRVVVTGRFNAIGEAVKAVSRRADKEGAASFYVVDTSDfGNSGNWRVVADLYK 90
                79*****************************************************9 PP

  == domain 2  score: 65.3 bits;  conditional E-value: 2e-22
                 EEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC...CTTEEEEEEEEE CS
     DUF1471   2 qpigtisvsgvfgspsdledalskkAdekGAkyYrItsare.nnggnlhatAelYK 56 
                 +p++t++v+g + s+++++da+ k+A++kGA++++I+++ + n+ggn+++tA +YK
  VIMSS15725 119 EPFDTVTVQGFYRSQPEVNDAITKAAKAKGAYSFYIVRQIDaNQGGNQRITAFIYK 174
                 8******************************************************9 PP

  == domain 3  score: 74.1 bits;  conditional E-value: 3.6e-25
                 EEEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC..CTTEEEEEEEEE CS
     DUF1471   1 lqpigtisvsgvfgspsdledalskkAdekGAkyYrItsarennggnlhatAelYK 56 
                 + p+++i++sg++g++++++++++k+A++kGAkyY+It++++++g+nl+++A+lYK
  VIMSS15725 259 MVPFDSIKFSGNYGNMTEVSYQVAKRAAKKGAKYYHITRQWQERGNNLTVSADLYK 314
                 679****************************************************9 PP



Or compare VIMSS15725 to CDD or PaperBLAST