PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS17309 to PF07338 (DUF1471)

VIMSS17309 has 87 amino acids

Query:       DUF1471  [M=56]
Accession:   PF07338.13
Description: Protein of unknown function (DUF1471)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      1e-26   79.0   0.1    1.6e-26   78.4   0.1    1.3  1  VIMSS17309  


Domain annotation for each sequence (and alignments):
>> VIMSS17309  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   78.4   0.1   1.6e-26   1.6e-26       2      56 .]      35      87 .]      34      87 .] 0.98

  Alignments for each domain:
  == domain 1  score: 78.4 bits;  conditional E-value: 1.6e-26
                EEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC..CTTEEEEEEEEE CS
     DUF1471  2 qpigtisvsgvfgspsdledalskkAdekGAkyYrItsarennggnlhatAelYK 56
                + igt+svsgv++sp+d+++ l+kkA+ekGA +Y+It+ar   g+++hatAelYK
  VIMSS17309 35 EAIGTVSVSGVASSPMDMREMLNKKAEEKGATAYQITEARS--GDTWHATAELYK 87
                579**************************************..***********9 PP



Or compare VIMSS17309 to CDD or PaperBLAST