PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS271225 to PF07338 (DUF1471)

VIMSS271225 has 87 amino acids

Query:       DUF1471  [M=56]
Accession:   PF07338.13
Description: Protein of unknown function (DUF1471)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.8e-26   76.9   0.1    7.8e-26   76.2   0.1    1.3  1  VIMSS271225  


Domain annotation for each sequence (and alignments):
>> VIMSS271225  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   76.2   0.1   7.8e-26   7.8e-26       1      56 []      34      87 .]      34      87 .] 0.99

  Alignments for each domain:
  == domain 1  score: 76.2 bits;  conditional E-value: 7.8e-26
                 EEEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC..CTTEEEEEEEEE CS
      DUF1471  1 lqpigtisvsgvfgspsdledalskkAdekGAkyYrItsarennggnlhatAelYK 56
                 lqp+gti+vsg  g+psd+++als kAd  GAk+Y ++++r   ++n+hatA++YK
  VIMSS271225 34 LQPMGTITVSGLNGAPSDIRQALSDKADTVGAKAYKVIEVRS--ENNWHATANIYK 87
                 8*****************************************..***********9 PP



Or compare VIMSS271225 to CDD or PaperBLAST