PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS274424 to PF07338 (DUF1471)

VIMSS274424 has 92 amino acids

Query:       DUF1471  [M=56]
Accession:   PF07338.13
Description: Protein of unknown function (DUF1471)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-25   75.1   0.3    2.8e-25   74.4   0.3    1.3  1  VIMSS274424  


Domain annotation for each sequence (and alignments):
>> VIMSS274424  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.4   0.3   2.8e-25   2.8e-25       1      56 []      39      92 .]      39      92 .] 0.98

  Alignments for each domain:
  == domain 1  score: 74.4 bits;  conditional E-value: 2.8e-25
                 EEEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC..CTTEEEEEEEEE CS
      DUF1471  1 lqpigtisvsgvfgspsdledalskkAdekGAkyYrItsarennggnlhatAelYK 56
                 +++igt+s++g+++sp+d+++alsk AdekG+kyY+I++ re  +g+++a Ae+YK
  VIMSS274424 39 YEKIGTVSTTGEATSPMDVKKALSKLADEKGGKYYVIIAERE--KGKFDADAEVYK 92
                 68****************************************..***********9 PP



Or compare VIMSS274424 to CDD or PaperBLAST