VIMSS3338749 has 86 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-18 52.8 0.5 2.2e-18 52.4 0.0 1.4 2 VIMSS3338749
Domain annotation for each sequence (and alignments):
>> VIMSS3338749
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -3.3 0.1 0.55 0.55 19 22 .. 22 25 .. 17 29 .. 0.45
2 ! 52.4 0.0 2.2e-18 2.2e-18 3 55 .] 36 86 .] 34 86 .] 0.96
Alignments for each domain:
== domain 1 score: -3.3 bits; conditional E-value: 0.55
YdgH_BhsA-like 19 leaa 22
++++
VIMSS3338749 22 AADE 25
2333 PP
== domain 2 score: 52.4 bits; conditional E-value: 2.2e-18
YdgH_BhsA-like 3 piGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
p G is+ + s+l++++aal+++ +++GA+++rI+s ++ +++++gtA++Y+
VIMSS3338749 36 PSGHISAG-NLSTLDEVTAALKARVEQAGASYFRITSLDG-KNKFYGTAVIYR 86
7799***9.*******************************.***********8 PP
Or compare VIMSS3338749 to CDD or PaperBLAST