PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3626992 to PF07338 (DUF1471)

VIMSS3626992 has 89 amino acids

Query:       DUF1471  [M=56]
Accession:   PF07338.13
Description: Protein of unknown function (DUF1471)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.9e-23   67.0   0.5      1e-22   66.2   0.4    1.4  2  VIMSS3626992  


Domain annotation for each sequence (and alignments):
>> VIMSS3626992  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.9   0.0      0.38      0.38       5      15 ..      14      23 ..      13      29 .. 0.56
   2 !   66.2   0.4     1e-22     1e-22       1      56 []      36      89 .]      36      89 .] 0.96

  Alignments for each domain:
  == domain 1  score: -2.9 bits;  conditional E-value: 0.38
                  EEEEECSS-SS CS
       DUF1471  5 gtisvsgvfgs 15
                  g+ s+s vf +
  VIMSS3626992 14 GSLSFS-VFAA 23
                  555666.5443 PP

  == domain 2  score: 66.2 bits;  conditional E-value: 1e-22
                  EEEEEEEEECSS-SSHHHHHHHHHHHHHHCT-SEEEECCECC..CTTEEEEEEEEE CS
       DUF1471  1 lqpigtisvsgvfgspsdledalskkAdekGAkyYrItsarennggnlhatAelYK 56
                  l++ig i++s   ++p+d++++lskkAde G+ yY+Itsa++ n+  +hatA++YK
  VIMSS3626992 36 LTKIGDITTS-DTTAPMDAKKELSKKADELGGTYYVITSANK-NEKSVHATADVYK 89
                  79********.******************************9.6666********9 PP



Or compare VIMSS3626992 to CDD or PaperBLAST