PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS363755 to PF07338 (YdgH_BhsA-like)

VIMSS363755 has 70 amino acids

Query:       YdgH_BhsA-like  [M=55]
Accession:   PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.6e-25   74.6   0.1    3.1e-25   74.3   0.1    1.1  1  VIMSS363755  


Domain annotation for each sequence (and alignments):
>> VIMSS363755  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.3   0.1   3.1e-25   3.1e-25       2      55 .]      19      70 .]      18      70 .] 0.99

  Alignments for each domain:
  == domain 1  score: 74.3 bits;  conditional E-value: 3.1e-25
  YdgH_BhsA-like  2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
                    q++Gtis++   ++l +le++la+kAd++GAks+rI+s+++ +++l+gtA++Yk
     VIMSS363755 19 QKVGTISAN-AGTNLGSLEEQLAQKADEMGAKSFRITSVTG-PNTLHGTAVIYK 70
                    9********.*******************************.***********9 PP



Or compare VIMSS363755 to CDD or PaperBLAST