VIMSS7446128 has 85 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-25 72.9 0.1 1.2e-24 72.4 0.1 1.2 1 VIMSS7446128
Domain annotation for each sequence (and alignments):
>> VIMSS7446128
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 72.4 0.1 1.2e-24 1.2e-24 2 55 .] 34 85 .] 33 85 .] 0.98
Alignments for each domain:
== domain 1 score: 72.4 bits; conditional E-value: 1.2e-24
YdgH_BhsA-like 2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
+++Gtis++ ++l +le++la+kAd++GA+sYrI+s+++ +++l+gtA++Yk
VIMSS7446128 34 HKVGTISAS-AGTNLGSLEDQLAQKADEMGATSYRITSVTG-PNTLHGTAVIYK 85
79*******.*******************************.***********9 PP
Or compare VIMSS7446128 to CDD or PaperBLAST