VIMSS92353 has 134 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-23 68.1 0.1 4.3e-23 67.4 0.1 1.4 1 VIMSS92353
Domain annotation for each sequence (and alignments):
>> VIMSS92353
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.4 0.1 4.3e-23 4.3e-23 1 55 [] 82 134 .] 82 134 .] 0.98
Alignments for each domain:
== domain 1 score: 67.4 bits; conditional E-value: 4.3e-23
YdgH_BhsA-like 1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
l p+Gt+s+t ++s+lsdle++la+kA ++GAk Y+I sa + ++++ gtA++Yk
VIMSS92353 82 LRPAGTVSAT-GASNLSDLEDKLAEKAREQGAKGYVINSAGG-NDQMFGTATIYK 134
689*******.*******************************.***********9 PP
Or compare VIMSS92353 to CDD or PaperBLAST