WP_006120963.1 has 87 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-26 77.7 0.4 4.1e-26 77.1 0.4 1.3 1 WP_006120963.1
Domain annotation for each sequence (and alignments):
>> WP_006120963.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.1 0.4 4.1e-26 4.1e-26 1 55 [] 34 87 .] 34 87 .] 0.99
Alignments for each domain:
== domain 1 score: 77.1 bits; conditional E-value: 4.1e-26
YdgH_BhsA-like 1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
lq++Gt+sv+gv++++sd++++l++kAd+ GAk++r+i+a + +gn+++tA+lYk
WP_006120963.1 34 LQSVGTVSVSGVAGAPSDIRQQLSEKADQHGAKAFRVIEAYN-DGNYHATAELYK 87
79****************************************.***********9 PP
Or compare WP_006120963.1 to CDD or PaperBLAST