WP_006809234.1 has 85 amino acids
Query: YdgH_BhsA-like [M=55] Accession: PF07338.17 Description: YdgH/BhsA/McbA-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-25 75.1 0.1 2.3e-25 74.7 0.1 1.2 1 WP_006809234.1 Domain annotation for each sequence (and alignments): >> WP_006809234.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.7 0.1 2.3e-25 2.3e-25 2 55 .] 34 85 .] 33 85 .] 0.99 Alignments for each domain: == domain 1 score: 74.7 bits; conditional E-value: 2.3e-25 YdgH_BhsA-like 2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55 q++Gtis+t ++l +le++la+kAd++GAks+rI+s+++ +++l+gtA++Yk WP_006809234.1 34 QKVGTISAT-AGTNLGSLEDQLAQKADEMGAKSFRITSVTG-PNTLHGTAVIYK 85 9********.*******************************.***********9 PP
Or compare WP_006809234.1 to CDD or PaperBLAST