WP_072927075.1 has 86 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-27 81.0 0.6 3.9e-27 80.4 0.6 1.3 1 WP_072927075.1
Domain annotation for each sequence (and alignments):
>> WP_072927075.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.4 0.6 3.9e-27 3.9e-27 1 55 [] 33 86 .] 33 86 .] 0.98
Alignments for each domain:
== domain 1 score: 80.4 bits; conditional E-value: 3.9e-27
YdgH_BhsA-like 1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
l+p+Gtisv+gv++s+sd+++al++kAd kGAk+Yr+i+a + +gn+++tA++Y+
WP_072927075.1 33 LTPAGTISVSGVSGSPSDIRQALSEKADSKGAKAYRVIEAYQ-NGNYHATAEIYQ 86
78****************************************.***********6 PP
Or compare WP_072927075.1 to CDD or PaperBLAST