PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS156538 to PF07510 (DUF1524)

VIMSS156538 has 553 amino acids

Query:       DUF1524  [M=139]
Accession:   PF07510.11
Description: Protein of unknown function (DUF1524)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-32   98.5   7.6    4.8e-32   96.9   7.6    1.9  1  VIMSS156538  


Domain annotation for each sequence (and alignments):
>> VIMSS156538  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   96.9   7.6   4.8e-32   4.8e-32       3     138 ..     418     545 ..     416     546 .. 0.92

  Alignments for each domain:
  == domain 1  score: 96.9 bits;  conditional E-value: 4.8e-32
      DUF1524   3 rdeefrrallnaklysssrkklryilakelesalreedeeegeakkltiEHilPqslaekwegagqedeekreelvndlgNLtlltkslNsslsnkpf 100
                   d++f ++++++k+ +++  +lryil  ++++++++e +  ++++k+ +EHi+P + +  w    +  +e++ee++ ++gNLtll +++N++  nk f
  VIMSS156538 418 ADDVFLNNFSSFKTTNKL--RLRYILK-KINDSYSKEIAVLNDNNKIHLEHIMPIKADG-W----DIIKEEHEEYLWKIGNLTLLGSEYNKKSTNKIF 507
                  589999999999999998..699****.***88888866666668888*******9988.6....699****************************** PP

      DUF1524 101 leKrdlykksslrlnrklaekdewdeeaiearqeaLak 138
                   +K+d y++s+ +l+rkl ++dew+ ++i++rq +La+
  VIMSS156538 508 NDKKDIYEYSEVQLTRKLLDYDEWNIDVIKERQVELAE 545
                  ************************************97 PP



Or compare VIMSS156538 to CDD or PaperBLAST